... DreamBook ...DreamHost Apps : Free WordPress hosting at your own domain and more!

Brian's Chibi Chibi Kingdom
Welcome to Dreambook, a nifty new free service from:
New Dream Network, Dreamhost, and Dreamservers!

If you have a minute, please sign my Dreambook too!


Name: Nicholas
E-mail address: nicholas@yahoo.ca
Homepage URL: http://www.galeon.com/jonvillar/claritin/claritine.html
Comments:Our partners :
zithromax is about zithromax... levitra drug is about levitra drug... You have an outstanding good and well structured site. I enjoyed browsing through it. Visit our site and have fun!
Wednesday, June 17th 2009 - 11:11:45 PM
Name: Preston Gregory Bryce
E-mail address: preston_gregory_bryce@earthlink.net
Homepage URL: http://alemed.t35.com/augmentin/
Comments:Gods Blessings to you and your family. The Lord is Faithful and I continue to look forward to the moving of Gods Spirit in your lives.
Wednesday, June 7th 2006 - 03:59:22 AM
Name: Armina
E-mail address: armina@cuteandsingle.com
Homepage URL: http://cuteandsingle.com
Comments:Very nice web site!
Sunday, April 20th 2003 - 12:01:24 AM
Name: Leslie C, Hamilton
Comments: Hiya! Just droppin' by!
Saturday, January 4th 2003 - 07:10:38 PM
Name: Lady Camigwen
E-mail address: camigwen@sailormoon.com
Homepage URL: http://cosmic-moon.cjb.net
Comments:Nice site. ^_^
Thursday, July 11th 2002 - 11:03:17 AM
Name: Bess
E-mail address: bess@cockatoo-birds.com
Homepage URL: http://www.cockatoo-birds.com
Comments:Great site. I liked it a lot.
Wednesday, July 10th 2002 - 09:35:22 AM
Name: ChibiSaturn
E-mail address: sailorsaturn10@hotmail.com
Comments:Well, I guess your site is ok... You could add alil more to it cuz it's kinda plain. Work hard and keep up the good work! ^_~ C'ya!!



~*ChibiSaturn*~
Saturday, May 25th 2002 - 11:34:57 AM
Name: kuni
Homepage URL: http://www.cafepress.com/cp/store/store.aspx?storeid=catgirls2
Comments:i love sailor moon!
Monday, April 15th 2002 - 07:35:43 AM
Name: lonely Babu
E-mail address: asian_princess43@msn.com
Comments:~Hey~
Great site......but i should have more then just a Dreambook ya no.......just for kicks.....
~latea~
Friday, April 5th 2002 - 11:34:10 PM
Name: Serenity
E-mail address: Angel2589@msn.com
Comments:I love your site, but how do you get to the pictures. And I think it is cool that some boys like sailor moon!(=
Tuesday, March 26th 2002 - 02:14:01 PM
Name: sailor saturn
E-mail address: sailorsaturn@wp.pl
Comments:hello there arent 45 other shenshis there are 5 inner(Usagi,Ami ,Rei ,Mako,Mina)&4 outer(Mihiru,Haruka,setsun,Hotaru)+ Taxido,Chib-usa,Chibichi,sailorcosmos(only in manga)there are alsow the 3 lights anndprincess Kakyu but of course there is alsow an uncountable amount of othe shenshis neve shown on t.v
Thursday, March 21st 2002 - 02:11:19 AM
Name: Hayley
Comments:i like chibi chibi.at least you made a website about a sailor soldier because some people like the moon kitties.well i like your site
Thursday, February 7th 2002 - 07:49:45 PM
Name: Taylor
E-mail address: SuperSailorVenus@worldnet.att.net
Comments:nice website
Thursday, November 22nd 2001 - 07:44:45 AM
Name: Robyn
E-mail address: robyn_abrams@yahoo.com
Homepage URL: http://robyn.freeservers.com
Comments:Cute page, though the pictures won't come up.
Saturday, September 22nd 2001 - 03:21:12 PM
Name: Leizel Joy
E-mail address: leizeljoy@hotmail.com
Homepage URL: http://gurlpages.com/azngurl4evah/intro.html
Comments:
...::: U hAvE bEeN tAgGeD by AzN gUrL 4 eVah! :::...

...:::TaGgED:::...

Yo ZuP dEr? I wUz JuZt CrUsIn ArOuNd WhEn I lAnDeD oN uR pAyGiE. i HavE tO sAy DaT u DiD a GoOd JoB oN iT, kEeP iT uP. wElL i DoN'T hAvE aNyThInG eLzE tO sAY sO I'm GoNnA BoUnCe OuTaH hErE. tAkE cArEzZz. BuH bYe. PeAyCe.
I lUv Ur SiTE ! ! !
MuCh LuV,
Leizel Joy
Mah Paygie
Tagged mah g-bookie
Tuesday, September 18th 2001 - 06:31:51 PM
Name: Mel
E-mail address: song15@usa.net
Comments:Bri, you don't find it just a teensy bit odd that you like a little girl's tv show?
Wednesday, June 20th 2001 - 08:02:04 PM
Name: Bunni
E-mail address: lunakitty_2000@hotmail.com
Homepage URL: http://www.geocities.com/senshistarlights/index.html
Comments:You know....someone said that chibi chibi was usagi's sister for pretend!! like chibi-usa said they were cousins so MAYBE the person who made this site meant that she was USAGI's sister FOR DISGUISE!!! DUH!!!! plus(to the webmaster) dont listen to these stupid ppl! they email me all the time and tell me my info is wrong...(even though I ALREADY KNEW IT WAS BEFORE I MADE THE SITE!!!!) so i know what youre goin through! ^_~ email me k ?
Tuesday, May 29th 2001 - 09:05:14 PM
Name: hayley
E-mail address: moonbabycrying2@bishoujosenshi.com
Comments:i love this site
Monday, May 21st 2001 - 03:55:59 PM
Name: Ken Hand
E-mail address: blair@zoicite.com
Homepage URL: http://www.zoicite.com/
Comments:Very nice website! =)
Friday, May 18th 2001 - 07:42:36 PM
Name: Christy
E-mail address: MaDpony9@aol.com
Comments:i just love chibix2. she is my favorite character, but ther is only a little info on her. do you have any suggestions to get info besides yours which in fact is the best over all. email me back
Saturday, May 12th 2001 - 04:59:44 PM
Name: whats in a name?
E-mail address: bogus_xxxx@hotmail.com
Homepage URL: http://none_that_i_know_off.nl
Comments:when will chibi star in a gundam wing movie?
Saturday, May 5th 2001 - 04:05:23 AM
Name: Chibi Chibi
E-mail address: kitty_kats90@hotmail.com
Comments:I think this site is good if you want to talk only about
chibi chibi, but you should have more pictures.
Sunday, April 29th 2001 - 09:08:15 AM
Name: ChibiChibi500
E-mail address: Master_of_Uranus
Tuesday, April 24th 2001 - 02:45:35 PM
Name: ccccchhhhhhhhhhhiiiiibbbbbiiiiiiii
E-mail address: cyfdt2@sdgfiegfuig4wiogoiprwpoirqpwqptfywqprtgfwqprgftwqprgpwqoruwqphfruwqerhfywqpiwryfiwqprypiqwyrpqwyfpwqyfrpweygrpwgypgy
Homepage URL: http://rehhjuyk';ljvsdgvbrbhfru3bdbchibichibihihich ecth hh.ca
Comments:rewgcreyyu8i
Saturday, March 17th 2001 - 05:44:32 PM
Name: ccccchhhhhhhhhhhiiiiibbbbbiiiiiiii
E-mail address: cyfdt2@sdgfiegfuig4wiogoiprwpoirqpwqptfywqprtgfwqprgftwqprgpwqoruwqphfruwqerhfywqpiwryfiwqprypiqwyrpqwyfpwqyfrpweygrpwgypgy
Homepage URL: http://rehhjuyk';ljvsdgvbrbhfru3bdbchibichibihihich ecth hh.ca
Comments:rewgcreyyu8i
Saturday, March 17th 2001 - 05:44:32 PM
Name: NGOC MOON
E-mail address: nhnguyen82@yahoo.com
Comments:This is a really great site.
Monday, March 12th 2001 - 05:17:00 PM
Name: SATRUN
E-mail address: SATRUN@AOL.COM
Friday, March 9th 2001 - 12:39:14 PM
Name: Sailor Pluto
Comments:Those idiots are all wrong! Your site is awesome! They are
just a bunch of scared babies! I'd chop ther head open if i
wanted to!
Wednesday, February 28th 2001 - 01:16:45 PM
Name: chibi chibi
Comments:Hi!i just wanted to tell u yer site is so cool just ignore
the people who dont like yer page. =) hope you add more
stuff
Saturday, February 17th 2001 - 10:33:50 AM
Name: chibi chibi
Comments:Hi!i just wanted to tell u yer site is so cool just ignore
the people who dont like yer page. =) hope you add more
stuff
Saturday, February 17th 2001 - 10:33:23 AM
Name: Sarah
E-mail address: sillyputty313@hotmail.com
Homepage URL: http://www.geocities.com/eternalsesnshisun
Comments:Way cool site!
Saturday, January 13th 2001 - 08:19:21 PM
Name: janne(nickname)
E-mail address: akane293@cs..com
Homepage URL: http://www,expage.com/chibiserenity
Comments:chibichibi is kewl and all.rini's kewl toono offes=nse for
the chibichibi's fans.
Sunday, December 31st 2000 - 07:37:05 PM
Name: Chibiri
E-mail address: chichiri09@gurlz.com
Comments:This is to SailorStarsaturn.(a purrson somewhere out there.)
Ok yo. Sailor Chibichibi Moon or just Chichibi is the GRAND
DAUGHTER of SAILOR MOON or Serena. Also the DAUGHTER of
CHIBI MOON or Rini.See, Rini or Sailor Chibi Moon is the
one that came from the future not Sailor Chibichibi Mooon
or Chibi Chibi.
GET IT STRAIGHT!!!
Saturday, December 30th 2000 - 11:02:59 AM
Name: Susie
E-mail address: got2havesailormoon@yahoo.com
Comments:Your site sucks bad!!!!!!!!!!!!!!!!!!!!!!!!!!!!
Wednesday, December 27th 2000 - 05:50:58 AM
Name: giulietta
E-mail address: toldo@ozlinx.com.au
Comments:love the cats
Sunday, December 17th 2000 - 08:28:08 PM
Name: ChibiMoon
E-mail address: chibi_moon87@hotmail.com
Homepage URL: http://none =(
Comments:ChibiChibi are not Sailor Moon´s sister!!!
ChibiUsa is much more cute like ChibiChibi!!!!!
I like ChibiUsa!!!!
And soon I am ChibiUsa´s voice in here Finland!!
^_^
Please E-mail me!!!
I like that! Your werbsite is so cute!
I like that!
- Moon Crisis Make Up!
Monday, November 6th 2000 - 10:18:54 AM
Name: Cheyenne
E-mail address: kgb883@aol.com
Comments:I think your web page is rill cool! But I think you can do
better and by the way peaches is rill cute. By
Thursday, November 2nd 2000 - 12:32:46 PM
Name: Cheyenne
E-mail address: kgb883@aol.com
Thursday, November 2nd 2000 - 12:27:34 PM
Name: Cheyenne
E-mail address: kgb883@aol.com
Thursday, November 2nd 2000 - 12:27:20 PM
Name: SailorStarsaturn
E-mail address: Vinae55@netzero.net
Comments:I think that your page is very cute, but the truth of the
matter is that I DO NOT like ChibiChibi or Sailor
ChibiChibiMoon, or Sailor Cosmos - pick any name that you
like. Before I get to my reason why, I just want to say
that ChibiChibi is NOT Sailormoon's little sister.
According to the anime, she is the starseed of Sailor
Galaxia and according to the manga, she is Sailorcosmos
from the future (note: if I remember correctly,
Sailorcosmos is the combination of EternalSailormoon and
SailorStarChibimoon). Anyway, I do not like ChibiChibi
because of the reason she came to the past in the manga.
In the future, Sailorchaos was taking over Crystal Tokyo,
and Neo-Queen Serenity just sat on her butt while the other
senshi were getting killed. Serenity thought that good
would always conquer evil, but here's the thing - good
cannot overcome evil if you DON'T DO ANYTHING ABOUT IT! So
when everyone except for Neo-Queen Serenity and Neo-
Princess Serenity (Small Lady) were dead, they combined
into Sailorcosmos and went to the past to change the
future. If ChibiChibi wasn't so stupid to begin with,
Sailorchaos would have been destroyed and no one would have
to die! That is why I dislike ChibiChibi. Thank you.
Saturday, October 28th 2000 - 05:06:28 PM
Name: Chibi Moon
Homepage URL: http://ChibiMoonsChaosZone.homestead.com/1.html
Comments:waaaaaaaaaaaaaaaa!
KAWIIE!!!!!
^_^
Saturday, October 21st 2000 - 11:34:55 AM
Name: Diana_baby
E-mail address: pretty_soilder@hotmail.com
Comments:I like Diana she is my favorite cat in
Sailormoon!!!!!!!!!!!!!!!!111
Friday, October 13th 2000 - 06:31:34 PM
Name: jerry phillips
E-mail address: michiru_nep37@hotmail.com
Comments:i like your site but i think that your info about chibi x2
being usagi's future sister is false...i watched to ending
series and it didn't say that chibi-chibi is usagi's
sister...just thought you should know
Tuesday, October 10th 2000 - 07:47:53 PM
Name: jerry phillips
E-mail address: michiru_nep37@hotmail.com
Comments:i like your site but i think that your info about chibi x2
being usagi's future sister is false...i watched to ending
series and it didn't say that chibi-chibi is usagi's
sister...just thought you should know
Tuesday, October 10th 2000 - 07:46:38 PM
Name: serinty
Comments:see you soon
Wednesday, August 23rd 2000 - 09:32:36 AM
Name: prinsess sernity
Wednesday, August 23rd 2000 - 09:30:43 AM
Name: sailor univurs
Wednesday, August 23rd 2000 - 09:27:56 AM
Name: brittany
Comments:can`t wait to see you on tv
Wednesday, August 23rd 2000 - 09:25:20 AM
Name: Ruka-Chan
E-mail address: onewiththesky@asianavenue.com
Homepage URL: http://members.fortunecity.com/moontwit/
Comments:Konnichi Wa. :0(
I was looking for pictures of Chibi Chibi to make my paper
doll of her when I came across the addy for your dreambook.
I read all the mean comments from everyone first then went
to your site. First of all, most of the comments in the
dreambook are correct, except for the ones saying that it's
a great page. I don't want to be mean so I'm going to give
you some suggestions. Go through the different webpages on
chibi chibi and get info about her that is CORRECT. make
sure that at least 5 other websites say that it is before
you put it on your website.
Make sure that your pictures work! That's very important.
No one will want to go to your webpage if they don't work.
^_^; And also, make another page just for your Chibi Chibi
pics, then put a link on the main page.
Get a book or 2 on html, that will help you alot with the
layout of this site. (if you need help on it, email me.)
Try a different server, like fortunecity.
And to also straighten out your facts just like the all the
other RUDE people on this thing! (there is such a thing as
common courtesy!)
Chibi Chibi is Galaxia's star seed. She came down from the
sky floating on a umbrella. :0)(cute huh?)
She follows Usagi around town, and then disappears. When
Usagi gets home she finds her mother telling her that she
should take care of her sister!
ok, on the other thing. There are more than 5 Sailor
Senshi, there are Moon, Mars, Mercury, Venus and jupiter,
but there are also Uranus, Neptune, Pluto, Saturn,
ChibiMoon, ChibiChibi, Sailor Star Healer, Maker, and
Fighter. There are more. But as for the 45 other senshi
thing, I don't think so.... ^_^;
Please visit my website, and if anyone wants to know what
the paper dolls will look like, go look at my fanart,
they'll be of the same quality, hopefully better. ja!
Friday, August 11th 2000 - 01:51:06 PM
Name: Silver Princess
E-mail address: neoprincess17@hotmail.com
Comments:Hi!Your chibi-chibi page is awful!You don't know anything
about her and you are giving false informations cause she
isn't Sailormoons sister(she only acts like her sister) or
Sailormoon from the future but Galaxias Starseed who is the
Good himself and helps Sailormoon free Galaxia from Chaos
and save the world. You should watch the Sailormoon series
carefully.
Friday, July 21st 2000 - 01:47:23 AM
[ Sign my Dreambook | Back to Brian's Chibi Chibi Kingdom ]

This Dreambook brought to you by
DreamHost Web Hosting